--- license: apache-2.0 datasets: - jheuschkel/cds-dataset language: - en pipeline_tag: fill-mask tags: - codon - Codon - biology - synthetic - dna - mrna - optimization - codon-optimization - codon-embedding - codon-representation - codon-language-model - codon-language misc: - codon new_version: jheuschkel/SynCodonLM-V2 --- # NOTE THIS IS THE PREPRINT VERSION OF SynCodonLM. SynCodonLM-V2 is the up to date model. # Model Card for SynCodonLM - This repository contains code to utilize the model, and reproduce results of the preprint [**Advancing Codon Language Modeling with Synonymous Codon Constrained Masking**](https://doi.org/10.1101/2025.08.19.671089). - Unlike other Codon Language Models, SynCodonLM was trained with logit-level control, masking logits for non-synonymous codons. This allowed the model to learn codon-specific patterns disentangled from protein-level semantics. - [Pre-training dataset of 66 Million CDS is available on Hugging Face here.](https://huggingface.co/datasets/jheuschkel/cds-dataset) --- ## Installation ```python git clone https://github.com/Boehringer-Ingelheim/SynCodonLM.git cd SynCodonLM pip install -r requirements.txt #maybe not neccesary depending on your env :) ``` --- # Usage #### SynCodonLM uses token-type ID's to add species-specific codon sontext to it's thinking. ###### Before use, find the token type ID (species_token_type) for your species of interest [here](https://github.com/Boehringer-Ingelheim/SynCodonLM/blob/master/SynCodonLM/species_token_type.py)! ###### Or use our list of model organisms [below]() --- ## Embedding a Coding DNA Sequence ```python from SynCodonLM import CodonEmbeddings model = CodonEmbeddings() #this loads the model & tokenizer using our built-in functions seq = 'ATGTCCACCGGGCGGTGA' mean_pooled_embedding = model.get_mean_embedding(seq, species_token_type=67) #E. coli #returns --> tensor of shape [768] raw_output = model.get_raw_embeddings(seq, species_token_type=67) #E. coli raw_embedding_final_layer = raw_output.hidden_states[-1] #treat this like a typical Hugging Face model dictionary based output! #returns --> tensor of shape [batch size (1), sequence length, 768] ``` ## Codon Optimizing a Protein Sequence ###### This has not yet been rigourosly evaluated, although we can confidently say it will generate 'natural looking' coding-DNA sequences. ```python from SynCodonLM import CodonOptimizer optimizer = CodonOptimizer() #this loads the model & tokenizer using our built-in functions result = optimizer.optimize( protein_sequence="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK", #GFP species_token_type=67, #E. coli deterministic=True #true by default ) codon_optimized_sequence = result.sequence ``` ## Citation If you use this work, please cite: ```bibtex @article {Heuschkel2025.08.19.671089, author = {Heuschkel, James and Kingsley, Laura and Pefaur, Noah and Nixon, Andrew and Cramer, Steven}, title = {Advancing Codon Language Modeling with Synonymous Codon Constrained Masking}, elocation-id = {2025.08.19.671089}, year = {2025}, doi = {10.1101/2025.08.19.671089}, publisher = {Cold Spring Harbor Laboratory}, abstract = {Codon language models offer a promising framework for modeling protein-coding DNA sequences, yet current approaches often conflate codon usage with amino acid semantics, limiting their ability to capture DNA-level biology. We introduce SynCodonLM, a codon language model that enforces a biologically grounded constraint: masked codons are only predicted from synonymous options, guided by the known protein sequence. This design disentangles codon-level from protein-level semantics, enabling the model to learn nucleotide-specific patterns. The constraint is implemented by masking non-synonymous codons from the prediction space prior to softmax. Unlike existing models, which cluster codons by amino acid identity, SynCodonLM clusters by nucleotide properties, revealing structure aligned with DNA-level biology. Furthermore, SynCodonLM outperforms existing models on 6 of 7 benchmarks sensitive to DNA-level features, including mRNA and protein expression. Our approach advances domain-specific representation learning and opens avenues for sequence design in synthetic biology, as well as deeper insights into diverse bioprocesses.Competing Interest StatementThe authors have declared no competing interest.}, URL = {https://www.biorxiv.org/content/early/2025/08/24/2025.08.19.671089}, eprint = {https://www.biorxiv.org/content/early/2025/08/24/2025.08.19.671089.full.pdf}, journal = {bioRxiv} } ``` ---- #### Model Organisms Species Token Type IDs | Organism | Token-Type ID | |-------------------------|----------------| | *E. coli* | 67 | | *S. cerevisiae* | 108 | | *C. elegans*| 187 | | *D. melanogaster*| 178 | | *D. rerio* |468 | | *M. musculus* | 321 | | *A. thaliana* | 266 | | *H. sapiens* | 317 | | *C. griseus* | 394 |